General Information

  • ID:  hor006613
  • Uniprot ID:  P01268
  • Protein name:  Parathyroid hormone
  • Gene name:  PTH
  • Organism:  Bos taurus (Bovine)
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031856 parathyroid hormone receptor binding; GO:0031857 type 1 parathyroid hormone receptor binding; GO:0048018 receptor ligand activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0006366 transcription by RNA polymerase II; GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0009059 macromolecule biosynthetic process; GO:0009967 positive regulation of signal transduction; GO:0010468 regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0010960 magnesium ion homeostasis; GO:0030282 bone mineralization; GO:0030501 positive regulation of bone mineralization; GO:0045725 positive regulation of glycogen biosynthetic process; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0046326 positive regulation of glucose import; GO:0048873 homeostasis of number of cells within a tissue; GO:0055062 phosphate ion homeostasis; GO:0055074 calcium ion homeostasis; GO:0060732 positive regulation of inositol phosphate biosynthetic process; GO:0071864 positive regulation of cell proliferation in bone marrow; GO:0071866 negative regulation of apoptotic process in bone marrow cell; GO:0090290 positive regulation of osteoclast proliferation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGASIAYRDGSSQRPRKKEDNVLVESHQKSLGEADKADVDVLIKAKPQ
  • Length:  84(32-115)
  • Propeptide:  MMSAKDMVKVMIVMLAICFLARSDGKSVKKRAVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGASIAYRDGSSQRPRKKEDNVLVESHQKSLGEADKADVDVLIKAKPQ
  • Signal peptide:  MMSAKDMVKVMIVMLAICFLARSDG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:   Q1LZF7
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01268-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006613_AF2.pdbhor006613_ESM.pdb

Physical Information

Mass: 1099050 Formula: C416H677N125O126S2
Absent amino acids: CT Common amino acids: KLSV
pI: 9.76 Basic residues: 18
Polar residues: 16 Hydrophobic residues: 29
Hydrophobicity: -64.64 Boman Index: -19547
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 87.02
Instability Index: 3486.31 Extinction Coefficient cystines: 6990
Absorbance 280nm: 84.22

Literature

  • PubMed ID:  388425
  • Title:  Cloning and nucleotide sequence of DNA coding for bovine preproparathyroid hormone.
  • PubMed ID:  6170060
  • Title:  Introduction by molecular cloning of artifactual inverted sequences at the 5' terminus of the sense strand of bovine parathyroid hormone cDNA.
  • PubMed ID:  6185374
  • Title:  Nucleotide sequence of bov
  • PubMed ID:  6086460
  • Title:  
  • PubMed ID:  4522780
  • Title:  
  • PubMed ID:  5531031
  • Title:  
  • PubMed ID:  5275384
  • Title:  
  • PubMed ID:  4322265
  • Title:  
  • PubMed ID:  10623601
  • Title: